PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca44899.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 546aa    MW: 60912.7 Da    PI: 4.4361
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca44899.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.13.5e-53151421128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 l+pGfrFhPtdeelv++yL++kv+gk++++ ++i+e+diykveP dLp  +k+k+++kewyfFs  d+ky +g r+nrat +gyWk+tgkd++v++ ++
  Dca44899.1  15 LAPGFRFHPTDEELVWYYLRRKVSGKSFRV-DAISEIDIYKVEPTDLPglSKLKTRDKEWYFFSALDRKYGNGMRTNRATVDGYWKTTGKDRPVVH-NS 111
                 579***************************.99***************6559999*****************************************.99 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 ++vg+kktLv++ grap+g++tdWvmhey+l
  Dca44899.1 112 RVVGMKKTLVYHFGRAPRGKRTDWVMHEYKL 142
                 9****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-6112165IPR003441NAC domain
PROSITE profilePS5100556.81215165IPR003441NAC domain
PfamPF023651.3E-2617142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
MGEKIESKKS SATSLAPGFR FHPTDEELVW YYLRRKVSGK SFRVDAISEI DIYKVEPTDL  60
PGLSKLKTRD KEWYFFSALD RKYGNGMRTN RATVDGYWKT TGKDRPVVHN SRVVGMKKTL  120
VYHFGRAPRG KRTDWVMHEY KLVDEQLDKA AYPLEGFVLC RIFRKSGTGP KNGEQYGAPF  180
VEEEWEDNEA ENVINVDVSF EDPYVDDAFI EQNDLVQDLE LVCPQAVPLL NNLDNQGSMN  240
SVEESKNTAG SDQMSTGAQD EYKIESHAFN DQEIFDLLTQ AGTSTEAVKN EYMPQVNVEH  300
NEASGNLPDE PSYNAGCNAP VDDGLYFDAA EFLDPAEVFP LDNDAFGPFF DDDLDIESFL  360
NFDSHPELTG GDTNQAFASD QNPESAFWHI PLASDQLARS NNDDAGSSSK QALVNKQSRT  420
ALSKANRWLE NIPAHPAFAS ELPSKDMESQ LRAAVQSSSI DMTAGMIRIR DAPVGVTRSG  480
LEWSFNKSGS VNVLLSFELP QTVGPAELES PSKLAAAVSR GWLYFLFLWA MFFAVSIKVG  540
TCIYAK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-4711651168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010694513.10.0PREDICTED: NAC domain-containing protein 78
TrEMBLA0A0J8BAC20.0A0A0J8BAC2_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-117NAC domain containing protein 2